PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim05g007180.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family HD-ZIP
Protein Properties Length: 306aa    MW: 34860.6 Da    PI: 6.3521
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim05g007180.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.97.1e-1879132356
                         --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         k+++++ eq+++Le+ Fe  +++  e++ +LA+ lgL+ rq+ +WFqNrRa++k
  Sopim05g007180.0.1  79 KKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWK 132
                         456899***********************************************9 PP

2HD-ZIP_I/II131.33.7e-4278170193
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         ekkrrl+ eqvk+LE++Fe  +kLeperK++lar+Lglqprq+a+WFqnrRAR+ktkqlEkdye Lkr++da+k+en++L++++++L++e+
  Sopim05g007180.0.1  78 EKKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWKTKQLEKDYELLKRQFDAIKAENDALQTQNQKLHAEI 168
                         69**************************************************************************************999 PP

         HD-ZIP_I/II  92 ke 93 
                         ++
  Sopim05g007180.0.1 169 MS 170
                         75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.4E-1955135IPR009057Homeodomain-like
SuperFamilySSF466892.18E-1970136IPR009057Homeodomain-like
PROSITE profilePS5007117.32974134IPR001356Homeobox domain
SMARTSM003891.8E-1777138IPR001356Homeobox domain
CDDcd000861.53E-1579135No hitNo description
PfamPF000463.1E-1579132IPR001356Homeobox domain
PRINTSPR000311.2E-5105114IPR000047Helix-turn-helix motif
PROSITE patternPS000270109132IPR017970Homeobox, conserved site
PRINTSPR000311.2E-5114130IPR000047Helix-turn-helix motif
PfamPF021836.2E-16134175IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009744Biological Processresponse to sucrose
GO:0048826Biological Processcotyledon morphogenesis
GO:0080022Biological Processprimary root development
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MAFFPTNFML QTPHNEDEHQ PSTSLNPILP SCSPQDFHGI ASFLGKRSMS FSGMDGNNGC  60
EENHGEDDLS DDGSQAGEKK RRLNMEQVKT LEKNFELGNK LEPERKMQLA RALGLQPRQI  120
AIWFQNRRAR WKTKQLEKDY ELLKRQFDAI KAENDALQTQ NQKLHAEIMS LKNREQPTES  180
INLNKETEGS CSNRSENSSE IKLDISRTPA IDSPLSNHHP NISSRPFFPP SMIRSNNNNN  240
NNGVVVPHQL FHINSSSSRQ DLKLMDQNTT TNNSSSVKEE SLSNMFCGID DQTSFWPWLE  300
QQHFN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1126134RRARWKTKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00225DAPTransfer from AT1G69780Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0115560.0AF011556.1 Lycopersicon esculentum jasmonic acid 1 (LEJA1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001296720.10.0jasmonic acid 1 2
SwissprotQ8LC031e-122ATB13_ARATH; Homeobox-leucine zipper protein ATHB-13
TrEMBLK4BWP40.0K4BWP4_SOLLC; Uncharacterized protein
STRINGSolyc05g007180.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8482498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.11e-123HD-ZIP family protein